Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DCTN3 Peptide - C-terminal region

DCTN3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DCTN-22, DCTN22, MGC111190

UniProt

O75355

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DCTN3 Rabbit Polyclonal Antibody (orb585339) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001239

Preservative

Lyophilized powder

AA Sequence

ARLQRLAQIHIQQQDQCVEITEESKALLEEYNKTTMLLSKQFVQWDELLC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARL17B (ARL17A) Human Gene Knockout Kit (CRISPR)
KN425073 1 Kit

ARL17B (ARL17A) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
10-trans,12-cis-Linoleic Acid
TRC-L462520-500MG 500 mg

10-trans,12-cis-Linoleic Acid

Sign In for Pricing
View Details
Golgi Complex (AE-6), CF640R conjugate, 0.1mg/mL
BNC400868-500 1x 500 µL

Golgi Complex (AE-6), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HLAA (HLA-A) Rabbit Polyclonal Antibody
TA377096 100 µL

HLAA (HLA-A) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ACE2 Antibody
KC-1951-01 50 μL

ACE2 Antibody

Sign In for Pricing
View Details
ACE2 Antibody
KC-1951-02 100 µL

ACE2 Antibody

Sign In for Pricing
View Details