Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dctn4 Peptide - C-terminal region

Dctn4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

1110001K06Rik, 4930547K17Rik, C130039E17Rik, p62

UniProt

Q3TQY2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Dctn4 Rabbit Polyclonal Antibody (orb583348) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_080578

Preservative

Lyophilized powder

AA Sequence

YDELAEPQDFQDDPDIVAFRKANKVGIFIKVTPQREEGEVTVCFKMKHDF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Whrn sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K4059706 1.0 µg DNA

Whrn sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Lentiviral mouse Apln shRNA (UAS) - Lentiviral mouse Apln shRNA (UAS) plasmid
GTR15231943 1 Vial

Lentiviral mouse Apln shRNA (UAS) - Lentiviral mouse Apln shRNA (UAS) plasmid

Sign In for Pricing
View Details
TSPYL6 Protein Vector (Human) (pPM-C-His)
PV140897 500 ng

TSPYL6 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Dimension
TRC-D424590-2.5MG 2.5 mg

Dimension

Sign In for Pricing
View Details
PIP5KL1 (NM_173492) Human Tagged ORF Clone Lentiviral Particle
RC207837L4V 200 µL

PIP5KL1 (NM_173492) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Human Kinesin-like protein KIF11, KIF11 ELISA Kit
MBS9318626-01 48 Well

Human Kinesin-like protein KIF11, KIF11 ELISA Kit

Sign In for Pricing
View Details