Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dctn4 Peptide - C-terminal region

Dctn4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

1110001K06Rik, 4930547K17Rik, C130039E17Rik, p62

UniProt

Q3TQY2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Dctn4 Rabbit Polyclonal Antibody (orb583348) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_080578

Preservative

Lyophilized powder

AA Sequence

YDELAEPQDFQDDPDIVAFRKANKVGIFIKVTPQREEGEVTVCFKMKHDF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Bovine Tubulin-specific chaperone D (TBCD) , partial
MBS1371209 Inquire

Recombinant Bovine Tubulin-specific chaperone D (TBCD) , partial

Sign In for Pricing
View Details
Pptc7 Mouse shRNA Plasmid (Locus ID 320717)
TL508365 1 Kit

Pptc7 Mouse shRNA Plasmid (Locus ID 320717)

Sign In for Pricing
View Details
Pack of 1000 Pes Syringe Filter 0.45µm, 25 Mm
SF25PE45M Pack of 1000

Pack of 1000 Pes Syringe Filter 0.45µm, 25 Mm

Sign In for Pricing
View Details
MIR5090 ORF Vector (Human) (pORF)
ORF024690 1.0 µg DNA

MIR5090 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Rabbit Polyclonal SLK Antibody [mFluor Violet 500 SE]
NBP2-98859MFV500 0.1 mL

Rabbit Polyclonal SLK Antibody [mFluor Violet 500 SE]

Sign In for Pricing
View Details
NEDD8 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
31684111 3x 1.0 µg

NEDD8 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details