Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DDO Peptide - N-terminal region

DDO Peptide - N-terminal region

Product Specifications

Product Name Alternative

DASOX, DDO-1, DDO-2, FLJ45203

UniProt

Q99489

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DDO Rabbit Polyclonal Antibody (orb584968) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003640

Preservative

Lyophilized powder

AA Sequence

TQKQWFRETFNHLFAIANSAEAGDAGVHLVSGWQIFQSTPTEEVPFWADV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACTH (Adrenocorticotrophic Hormone) (AH26), CF488A conjugate, 0.1mg/mL
BNC880026-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF594 conjugate, 0.1mg/mL
BNC940391-100 1x 100 µL

CD81 / TAPA-1 (1.3.3.22), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP27 (G3.1), CF594 conjugate, 0.1mg/mL
BNC940861-500 1x 500 µL

HSP27 (G3.1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (156-3C11), CF594 conjugate, 0.1mg/mL
BNC940460-100 1x 100 µL

CD44 Standard (156-3C11), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF594 conjugate, 0.1mg/mL
BNC940026-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fascin-1 (FSCN1/417), CF640R conjugate, 0.1mg/mL
BNC400417-500 1x 500 µL

Fascin-1 (FSCN1/417), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details