Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DDO Peptide - C-terminal region

DDO Peptide - C-terminal region

Product Specifications

Product Name Alternative

DASOX, DDO-1, DDO-2, FLJ45203

UniProt

Q99489

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DDO Rabbit Polyclonal Antibody (orb584969) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004023

Preservative

Lyophilized powder

AA Sequence

RDGSGLTYIYPGTSHVTLGGTRQKGDWNLSPDAENSREILSRCCALEPSL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DUSP4 (Dual Specificity Phosphatase 4, TYP, HVH2, MKP2, MKP-2) (MaxLight 650)
MBS6414745-01 0.1 mL

DUSP4 (Dual Specificity Phosphatase 4, TYP, HVH2, MKP2, MKP-2) (MaxLight 650)

Sign In for Pricing
View Details
DUSP4 (Dual Specificity Phosphatase 4, TYP, HVH2, MKP2, MKP-2) (MaxLight 650)
MBS6414745-02 5x 0.1 mL

DUSP4 (Dual Specificity Phosphatase 4, TYP, HVH2, MKP2, MKP-2) (MaxLight 650)

Sign In for Pricing
View Details
CHODL Protein (C-human IgG1-Fc, Mouse)
P523347 100 µg

CHODL Protein (C-human IgG1-Fc, Mouse)

Sign In for Pricing
View Details
Mature Macrophage Marker antibody (biotin)
61R-1470 100 ug

Mature Macrophage Marker antibody (biotin)

Sign In for Pricing
View Details
EIF4G (1N7) Rabbit Monoclonal Antibody
E28G2673 100 µL

EIF4G (1N7) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
TFAP2A ORF Vector (Human) (pORF)
46556011 1.0 µg DNA

TFAP2A ORF Vector (Human) (pORF)

Sign In for Pricing
View Details