Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DDO Peptide - C-terminal region

DDO Peptide - C-terminal region

Product Specifications

Product Name Alternative

DASOX, DDO-1, DDO-2, FLJ45203

UniProt

Q99489

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DDO Rabbit Polyclonal Antibody (orb584969) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004023

Preservative

Lyophilized powder

AA Sequence

RDGSGLTYIYPGTSHVTLGGTRQKGDWNLSPDAENSREILSRCCALEPSL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KLC3 Protein Vector (Human) (pPB-C-His)
PV022749 500 ng

KLC3 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Rabbit Monoclonal MARCO Antibody (PLK1) [PerCP]
NBP3-12048PCP 0.1 mL

Rabbit Monoclonal MARCO Antibody (PLK1) [PerCP]

Sign In for Pricing
View Details
Anti-FRA1/FOSL1 Antibody Picoband® (FITC Conjugate)
A03927-1-FITC 100 µg/Vial

Anti-FRA1/FOSL1 Antibody Picoband® (FITC Conjugate)

Sign In for Pricing
View Details
Recombinant Oligotropha carboxidovorans Trigger factor (tig)
MBS1230741-01 0.02 mg (E-Coli)

Recombinant Oligotropha carboxidovorans Trigger factor (tig)

Sign In for Pricing
View Details
Recombinant Oligotropha carboxidovorans Trigger factor (tig)
MBS1230741-02 0.02 mg (Yeast)

Recombinant Oligotropha carboxidovorans Trigger factor (tig)

Sign In for Pricing
View Details
Recombinant Oligotropha carboxidovorans Trigger factor (tig)
MBS1230741-03 0.1 mg (E-Coli)

Recombinant Oligotropha carboxidovorans Trigger factor (tig)

Sign In for Pricing
View Details