Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ddx20 Peptide - N-terminal region

Ddx20 Peptide - N-terminal region

Product Specifications

Product Name Alternative

GEMIN3, MGC159174, dp103

UniProt

Q059Z6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ddx20 Rabbit Polyclonal Antibody (orb576253) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_059093

Preservative

Lyophilized powder

AA Sequence

RRPIPARSRLVMLPKVETEAPGLVRSHGEQGQMPENMQVSQFKMVNYSYD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-ARFGAP3 antibody
SL12513R-01 50 µL

Rabbit Anti-ARFGAP3 antibody

Sign In for Pricing
View Details
Rabbit Anti-ARFGAP3 antibody
SL12513R-02 100 µL

Rabbit Anti-ARFGAP3 antibody

Sign In for Pricing
View Details
Rabbit Coiled coil domain containing protein 25 (CCDC25) ELISA Kit
GTR10312873 96 Well

Rabbit Coiled coil domain containing protein 25 (CCDC25) ELISA Kit

Sign In for Pricing
View Details
ILK-1 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-0317R-BF680 100 µL

ILK-1 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
CD3E Recombinant Antibody, Cy7 Conjugated
bsm-60635R-Cy7-TR 20 µL

CD3E Recombinant Antibody, Cy7 Conjugated

Sign In for Pricing
View Details
Wdr76 3'UTR Luciferase Stable Cell Line
TU223370 1.0 mL

Wdr76 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details