Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ddx20 Peptide - N-terminal region

Ddx20 Peptide - N-terminal region

Product Specifications

Product Name Alternative

GEMIN3, MGC159174, dp103

UniProt

Q059Z6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ddx20 Rabbit Polyclonal Antibody (orb576253) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_059093

Preservative

Lyophilized powder

AA Sequence

RRPIPARSRLVMLPKVETEAPGLVRSHGEQGQMPENMQVSQFKMVNYSYD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human VPS4B Protein, His, E.coli-1mg
QP13946-1mg 1mg

Recombinant Human VPS4B Protein, His, E.coli-1mg

Sign In for Pricing
View Details
MRPS26 Human qPCR Template Standard (NM_030811)
HK204895 1 Kit

MRPS26 Human qPCR Template Standard (NM_030811)

Sign In for Pricing
View Details
ATG13 (S355.) Blocking peptide
orb1443464 500 µg

ATG13 (S355.) Blocking peptide

Sign In for Pricing
View Details
ANT-1 Rabbit Polyclonal Antibody (Cy3)
orb990100 100 µL

ANT-1 Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
GGT3 rabbit pAb
UB-GEN-7874 100 µL

GGT3 rabbit pAb

Sign In for Pricing
View Details
Mouse Toll Like Receptor 3 (TLR3) ELISA Kit
MBS4502937-01 48 Tests

Mouse Toll Like Receptor 3 (TLR3) ELISA Kit

Sign In for Pricing
View Details