Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Decr2 Peptide - C-terminal region

Decr2 Peptide - C-terminal region

Product Specifications

UniProt

Q9WV68

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Decr2 Rabbit Polyclonal Antibody (orb578869) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_036063

Preservative

Lyophilized powder

AA Sequence

PIPRLGTKTEIAHSVLYLASPLASYVSGIVLVVDGGSWMTFPNGIKQLLE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Western Blot Boxes
B1200-11 5 Units/Pack

Western Blot Boxes

Sign In for Pricing
View Details
Histone H3 (acetyl K4) Recombinant Rabbit Monoclonal Antibody [PSH03-71]
HA722035 100 µL

Histone H3 (acetyl K4) Recombinant Rabbit Monoclonal Antibody [PSH03-71]

Sign In for Pricing
View Details
Phenol-2,4,6-d3
TRC-P318004-10MG 10 mg

Phenol-2,4,6-d3

Sign In for Pricing
View Details
c-Jun (JUN) non phospho Ser63 Rabbit Polyclonal Antibody
AP02545PU-N 100 µL

c-Jun (JUN) non phospho Ser63 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Lactitol Monohydrate
TRC-L069125-500MG 500 mg

Lactitol Monohydrate

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS622090 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details