Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Decr2 Peptide - C-terminal region

Decr2 Peptide - C-terminal region

Product Specifications

UniProt

Q9WV68

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Decr2 Rabbit Polyclonal Antibody (orb578869) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_036063

Preservative

Lyophilized powder

AA Sequence

PIPRLGTKTEIAHSVLYLASPLASYVSGIVLVVDGGSWMTFPNGIKQLLE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Kidney
CS635341 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
ERAB (HSD17B10) (C-term) Rabbit Polyclonal Antibody
AP13329PU-N 400 µL

ERAB (HSD17B10) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TMEM177 (NM_001105198) Human Over-expression Lysate
LC426222 20 µg

TMEM177 (NM_001105198) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant ACTA1 Antibody
RC-4200-01 50 μL

Recombinant ACTA1 Antibody

Sign In for Pricing
View Details
Recombinant ACTA1 Antibody
RC-4200-02 100 µL

Recombinant ACTA1 Antibody

Sign In for Pricing
View Details
Recombinant ACTA1 Antibody
RC-4200-03 1 mL

Recombinant ACTA1 Antibody

Sign In for Pricing
View Details