Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DEFB4A Peptide - N-terminal region

DEFB4A Peptide - N-terminal region

Product Specifications

Product Name Alternative

DEFB-2, DEFB102, DEFB2, DEFB4, HBD-2, SAP1, BD-2

UniProt

O15263

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DEFB4A Rabbit Polyclonal Antibody (orb584601) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004933

Preservative

Lyophilized powder

AA Sequence

LLFSFLFIFLMPLPGVFGGIGDPVTCLKSGAICHPVFCPRRYKQIGTCGL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CPA5 (NM_080385) Human Recombinant Protein
TP307397M 100 µg

CPA5 (NM_080385) Human Recombinant Protein

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS709282 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Scube3 Mouse Gene Knockout Kit (CRISPR)
KN515412 1 Kit

Scube3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD5 (Mantle Cell Lymphoma Marker) (CD5/2418), CF405S conjugate, 0.1mg/mL
BNC042418-500 1x 500 µL

CD5 (Mantle Cell Lymphoma Marker) (CD5/2418), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Large Capacity Water Purification System BCPS-401
BCPS-401 1 Unit

Large Capacity Water Purification System BCPS-401

Sign In for Pricing
View Details
TMEM106B (NM_001134232) Human Over-expression Lysate
LY427384 100 µg

TMEM106B (NM_001134232) Human Over-expression Lysate

Sign In for Pricing
View Details