Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DEFB4A Peptide - N-terminal region

DEFB4A Peptide - N-terminal region

Product Specifications

Product Name Alternative

DEFB-2, DEFB102, DEFB2, DEFB4, HBD-2, SAP1, BD-2

UniProt

O15263

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DEFB4A Rabbit Polyclonal Antibody (orb584601) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004933

Preservative

Lyophilized powder

AA Sequence

LLFSFLFIFLMPLPGVFGGIGDPVTCLKSGAICHPVFCPRRYKQIGTCGL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(2,4,6-Trichlorophenoxy)acetic Acid-13C6
TRC-T774582-5MG 5 mg

(2,4,6-Trichlorophenoxy)acetic Acid-13C6

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS645695 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
Human CCDC28A activation kit by CRISPRa
GA108617 1 Kit

Human CCDC28A activation kit by CRISPRa

Sign In for Pricing
View Details
Beta-2-Microglobulin (B2M) (B2M/1118), CF647 conjugate, 0.1mg/mL
BNC471118-100 1x 100 µL

Beta-2-Microglobulin (B2M) (B2M/1118), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Trilostane
TRC-T795600-10MG 10 mg

Trilostane

Sign In for Pricing
View Details
CD106 / VCAM1 (VCAM1/843), CF740 conjugate, 0.1mg/mL
BNC740843-100 1x 100 µL

CD106 / VCAM1 (VCAM1/843), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details