Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DENND1A Peptide - N-terminal region

DENND1A Peptide - N-terminal region

Product Specifications

Product Name Alternative

FAM31A, FLJ38464, KIAA1608, RP11-230L22.3

UniProt

Q8TEH3

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DENND1A Rabbit Polyclonal Antibody (orb583586) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_065997

Preservative

Lyophilized powder

AA Sequence

PGVSVHLSVHSYFTVPDTRELPSIPENRNLTEYFVAVDVNNMLHLYASML

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CFP Tag  (Monoclonal)
G164 100 µg

Anti-CFP Tag (Monoclonal)

Sign In for Pricing
View Details
Mouse ENG (Endoglin) ELISA Kit
E-EL-M1072-01 24 Tests

Mouse ENG (Endoglin) ELISA Kit

Sign In for Pricing
View Details
Mouse ENG (Endoglin) ELISA Kit
E-EL-M1072-02 48 Tests

Mouse ENG (Endoglin) ELISA Kit

Sign In for Pricing
View Details
Mouse ENG (Endoglin) ELISA Kit
E-EL-M1072-03 96 Tests

Mouse ENG (Endoglin) ELISA Kit

Sign In for Pricing
View Details
Recombinant Mouse CCL3
6655 5 µg

Recombinant Mouse CCL3

Sign In for Pricing
View Details
Large Capacity Water Purification System BCPS-312
BCPS-312 1 Unit

Large Capacity Water Purification System BCPS-312

Sign In for Pricing
View Details