Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DENND1A Peptide - N-terminal region

DENND1A Peptide - N-terminal region

Product Specifications

Product Name Alternative

FAM31A, FLJ38464, KIAA1608, RP11-230L22.3

UniProt

Q8TEH3

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DENND1A Rabbit Polyclonal Antibody (orb583586) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_065997

Preservative

Lyophilized powder

AA Sequence

PGVSVHLSVHSYFTVPDTRELPSIPENRNLTEYFVAVDVNNMLHLYASML

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Alkaline Phosphatase (ALPI) (NM_001631) Human Over-expression Lysate
LC400612 20 µg

Alkaline Phosphatase (ALPI) (NM_001631) Human Over-expression Lysate

Sign In for Pricing
View Details
DAPK3 (Ab-265) Antibody
8B0900-AAT 50 µg

DAPK3 (Ab-265) Antibody

Sign In for Pricing
View Details
Human ZNF107 activation kit by CRISPRa
GA109798 1 Kit

Human ZNF107 activation kit by CRISPRa

Sign In for Pricing
View Details
4-Aminophenyl Alpha-D-Glucopyranoside
TRC-A626990-10MG 10 mg

4-Aminophenyl Alpha-D-Glucopyranoside

Sign In for Pricing
View Details
EcoRI, 100 preps
FDRE1260 100 Preparations

EcoRI, 100 preps

Sign In for Pricing
View Details
CD21 (Mature B-Cell & Follicular Dendritic Cell Marker) (rCR2/1952), CF740 conjugate, 0.1mg/mL
BNC743789-100 1x 100 µL

CD21 (Mature B-Cell & Follicular Dendritic Cell Marker) (rCR2/1952), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details