DEPDC1 Peptide - middle region
DEPDC1 Peptide - middle region
Product Specifications
Product Name Alternative
DEP.8, DEPDC1-V2, DEPDC1A, FLJ20354, SDP35
UniProt
Q5TB30
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with DEPDC1 Rabbit Polyclonal Antibody (orb583101) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001107592
Preservative
Lyophilized powder
AA Sequence
PEPLLTFEYYELFVNILVVCGYITVSDRSSGIHKIQDDPQSSKFLHLNNL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Caspase-8 Recombinant Rabbit Monoclonal Antibody [SZ01-08]](https://cdn.genprice.uk/products/992/68dd1c8a061270361ea80f67/imageurl/et1603-16.webp)
ET1603-16 100 µL
Caspase-8 Recombinant Rabbit Monoclonal Antibody [SZ01-08]
Sign In for Pricing
View Details 
BV1007 1 Each
BenchMixer™ MP with attachments for plates, 30x2.0ml, 12x15ml, 4x50ml and cup head attachment, 115V
Sign In for Pricing
View Details 
TRC-S699500-250MG 250 mg
Sulfo-N-succinimidyl 6-(biotinamido) hexanoate Sodium Salt(~90%)
Sign In for Pricing
View Details