Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DEPDC7 Peptide - N-terminal region

DEPDC7 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DJ85M6.4, TR2

UniProt

Q95JW3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DEPDC7 Rabbit Polyclonal Antibody (orb581415) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_631899

Preservative

Lyophilized powder

AA Sequence

FGKDKKPTFEDSSCSLYRFTTIPNQDSQLGKENKLYSPARYADALFKSSD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human EGLN1 Protein
E30P1423 20 µg

Recombinant Human EGLN1 Protein

Sign In for Pricing
View Details
Recombinant Moorella thermoacetica Acetylglutamate kinase (argB)
MBS1383210-01 0.02 mg (E-Coli)

Recombinant Moorella thermoacetica Acetylglutamate kinase (argB)

Sign In for Pricing
View Details
Recombinant Moorella thermoacetica Acetylglutamate kinase (argB)
MBS1383210-02 0.02 mg (Yeast)

Recombinant Moorella thermoacetica Acetylglutamate kinase (argB)

Sign In for Pricing
View Details
Recombinant Moorella thermoacetica Acetylglutamate kinase (argB)
MBS1383210-03 0.1 mg (E-Coli)

Recombinant Moorella thermoacetica Acetylglutamate kinase (argB)

Sign In for Pricing
View Details
Recombinant Moorella thermoacetica Acetylglutamate kinase (argB)
MBS1383210-04 0.1 mg (Yeast)

Recombinant Moorella thermoacetica Acetylglutamate kinase (argB)

Sign In for Pricing
View Details
Recombinant Moorella thermoacetica Acetylglutamate kinase (argB)
MBS1383210-05 0.02 mg (Baculovirus)

Recombinant Moorella thermoacetica Acetylglutamate kinase (argB)

Sign In for Pricing
View Details