Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DEPDC7 Peptide - N-terminal region

DEPDC7 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DJ85M6.4, TR2

UniProt

Q95JW3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DEPDC7 Rabbit Polyclonal Antibody (orb581415) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_631899

Preservative

Lyophilized powder

AA Sequence

FGKDKKPTFEDSSCSLYRFTTIPNQDSQLGKENKLYSPARYADALFKSSD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CDHH (CDH13) Mouse Monoclonal Antibody [Clone ID: OTI3H6]
M01986 100 µL

Anti-CDHH (CDH13) Mouse Monoclonal Antibody [Clone ID: OTI3H6]

Sign In for Pricing
View Details
[KO Validated] MYOF Rabbit pAb
E45R29470N-50 50 µL

[KO Validated] MYOF Rabbit pAb

Sign In for Pricing
View Details
3-Benzyloxy-5-hydroxyphenylpropenoic Acid 3-O-b-D-Glucuronide
B286490 2.5 mg

3-Benzyloxy-5-hydroxyphenylpropenoic Acid 3-O-b-D-Glucuronide

Sign In for Pricing
View Details
Lentiviral mouse Srprb shRNA (UAS) - Lentiviral mouse Srprb shRNA (UAS) (100)
GTR15180834 1 Vial

Lentiviral mouse Srprb shRNA (UAS) - Lentiviral mouse Srprb shRNA (UAS) (100)

Sign In for Pricing
View Details
NELIN CRISPR Activation Plasmid (h)
sc-413904-ACT 20 µg

NELIN CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
Bovine Immunoglobulin Transcription Factor 2 ELISA Kit
MBS7263842-01 48 Well

Bovine Immunoglobulin Transcription Factor 2 ELISA Kit

Sign In for Pricing
View Details