Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AWAT1 Peptide - N-terminal region

AWAT1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

AWAT1, DGA2, DGAT2L3

UniProt

Q58HT5

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AWAT1 Rabbit Polyclonal Antibody (orb325177) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001013597

Preservative

Lyophilized powder

AA Sequence

NWCVWTHIRDYFPITILKTKDLSPEHNYLMGVHPHGLLTFGAFCNFCTEA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IgG Immunoglobulin (IG266), CF647 conjugate, 0.1mg/mL
BNC470266-100 1x 100 µL

Human IgG Immunoglobulin (IG266), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (190-2F2.5), CF488A conjugate, 0.1mg/mL
BNC881081-500 1x 500 µL

CD45RO (190-2F2.5), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF647 conjugate, 0.1mg/mL
BNC470160-500 1x 500 µL

CD20 (B9E9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF488A conjugate, 0.1mg/mL
BNC880039-500 1x 500 µL

CD34 (ICO-115), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Kappa Light Chain (B-Cell Marker) (rKLC264), CF594 conjugate, 0.1mg/mL
BNC942171-500 1x 500 µL

Human Kappa Light Chain (B-Cell Marker) (rKLC264), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (KRT8/803 + KRT18/835), CF568 conjugate, 0.1mg/mL
BNC680979-500 1x 500 µL

Cytokeratin 8/18 (KRT8/803 + KRT18/835), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details