Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DGKQ Peptide - middle region

DGKQ Peptide - middle region

Product Specifications

Product Name Alternative

DAGK, DAGK4, DAGK7

UniProt

P52824

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DGKQ Rabbit Polyclonal Antibody (orb581512) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001338

Preservative

Lyophilized powder

AA Sequence

DAELSLDFHQAREEEPGKFTSRLHNKGVYVRVGLQKISHSRSLHKQIRLQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-GluN2A/NR2A Glutamate Receptor (N327/95) Recombinant Chicken Chimeric mAb
78-288 100 µL

Anti-GluN2A/NR2A Glutamate Receptor (N327/95) Recombinant Chicken Chimeric mAb

Sign In for Pricing
View Details
ZNF791 antibody
70R-8446 50 ug

ZNF791 antibody

Sign In for Pricing
View Details
Nori® Rabbit beta-defensin 1 ELISA Kit
GR144168 96 Well

Nori® Rabbit beta-defensin 1 ELISA Kit

Sign In for Pricing
View Details
Ammonium sulfate, 1kg
2019-1kg 1 Kg

Ammonium sulfate, 1kg

Sign In for Pricing
View Details
PTPN2 siRNA Oligos set (Human)
38152171 3x 5 nmol

PTPN2 siRNA Oligos set (Human)

Sign In for Pricing
View Details
H2al1a Mouse shRNA Plasmid (Locus ID 100042922)
TR518661 1 Kit

H2al1a Mouse shRNA Plasmid (Locus ID 100042922)

Sign In for Pricing
View Details