Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DGKQ Peptide - middle region

DGKQ Peptide - middle region

Product Specifications

Product Name Alternative

DAGK, DAGK4, DAGK7

UniProt

P52824

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DGKQ Rabbit Polyclonal Antibody (orb581512) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001338

Preservative

Lyophilized powder

AA Sequence

DAELSLDFHQAREEEPGKFTSRLHNKGVYVRVGLQKISHSRSLHKQIRLQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal TAFA3/FAM19A3 Antibody (460904) [CoraFluor 1]
FAB4677CL1 0.1 mL

Mouse Monoclonal TAFA3/FAM19A3 Antibody (460904) [CoraFluor 1]

Sign In for Pricing
View Details
DDR2 (3B11E4) : m-IgG2a BP-HRP Bundle
sc-547153 1 Kit

DDR2 (3B11E4) : m-IgG2a BP-HRP Bundle

Sign In for Pricing
View Details
hsa-miR-5582-5p miRNA Antagomir
MBS8317747-01 10 nmol

hsa-miR-5582-5p miRNA Antagomir

Sign In for Pricing
View Details
hsa-miR-5582-5p miRNA Antagomir
MBS8317747-02 20 nmol

hsa-miR-5582-5p miRNA Antagomir

Sign In for Pricing
View Details
hsa-miR-5582-5p miRNA Antagomir
MBS8317747-03 5x 20 nmol

hsa-miR-5582-5p miRNA Antagomir

Sign In for Pricing
View Details
Neuropeptide S (NPS) Antibody
abx173788 1 mL

Neuropeptide S (NPS) Antibody

Sign In for Pricing
View Details