Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DHFR2 Peptide - middle region

DHFR2 Peptide - middle region

Product Specifications

Product Name Alternative

DHFRL1, DHFRP4

UniProt

Q86XF0

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DHFR2 Rabbit Polyclonal Antibody (orb582038) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_789785

Preservative

Lyophilized powder

AA Sequence

RINLVLSRELKEPPQGAHFLARSLDDALKLTERPELANKVDMIWIVGGSS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nalidixic Acid
TRC-N275600-50MG 50 mg

Nalidixic Acid

Sign In for Pricing
View Details
IL17RA Human
OM296452-01 1 µg

IL17RA Human

Sign In for Pricing
View Details
IL17RA Human
OM296452-02 5 µg

IL17RA Human

Sign In for Pricing
View Details
IL17RA Human
OM296452-03 50 µg

IL17RA Human

Sign In for Pricing
View Details
Human SDF1 (CXCL12) activation kit by CRISPRa
GA104342 1 Kit

Human SDF1 (CXCL12) activation kit by CRISPRa

Sign In for Pricing
View Details
CD34 Class I Mouse Monoclonal Antibody [Clone ID: B-C34]
AM31235AF-N 200 µg

CD34 Class I Mouse Monoclonal Antibody [Clone ID: B-C34]

Sign In for Pricing
View Details