Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DHFR2 Peptide - middle region

DHFR2 Peptide - middle region

Product Specifications

Product Name Alternative

DHFRL1, DHFRP4

UniProt

Q86XF0

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DHFR2 Rabbit Polyclonal Antibody (orb582038) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_789785

Preservative

Lyophilized powder

AA Sequence

RINLVLSRELKEPPQGAHFLARSLDDALKLTERPELANKVDMIWIVGGSS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Breast
CS646572 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
XBP1 (NM_001079539) Human Over-expression Lysate
LY421527 100 µg

XBP1 (NM_001079539) Human Over-expression Lysate

Sign In for Pricing
View Details
(S)-(+)-N-3-Benzylnirvanol
TRC-B285775-50MG 50 mg

(S)-(+)-N-3-Benzylnirvanol

Sign In for Pricing
View Details
Adiponectin (ADIPOQ) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3D3]
TA805085BM 100 µL

Adiponectin (ADIPOQ) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3D3]

Sign In for Pricing
View Details
Human IL-3, Tag Free
HA210928-01 20 µg

Human IL-3, Tag Free

Sign In for Pricing
View Details
Human IL-3, Tag Free
HA210928-02 50 µg

Human IL-3, Tag Free

Sign In for Pricing
View Details