Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dhrs3 Peptide - middle region

Dhrs3 Peptide - middle region

Product Specifications

Product Name Alternative

Rsdr1, retSDR1

UniProt

O88876

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Dhrs3 Rabbit Polyclonal Antibody (orb579804) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_035433

Preservative

Lyophilized powder

AA Sequence

PGVSATTVLPFHTSTEMFQGMRVRFPNLFPPLKPETVARRTVDAVQQNQA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Flap endonuclease 1, FEN1 ELISA Kit
MBS9339023-01 48 Well

Rat Flap endonuclease 1, FEN1 ELISA Kit

Sign In for Pricing
View Details
Rat Flap endonuclease 1, FEN1 ELISA Kit
MBS9339023-02 96 Well

Rat Flap endonuclease 1, FEN1 ELISA Kit

Sign In for Pricing
View Details
Rat Flap endonuclease 1, FEN1 ELISA Kit
MBS9339023-03 5x 96 Well

Rat Flap endonuclease 1, FEN1 ELISA Kit

Sign In for Pricing
View Details
Rat Flap endonuclease 1, FEN1 ELISA Kit
MBS9339023-04 10x 96 Well

Rat Flap endonuclease 1, FEN1 ELISA Kit

Sign In for Pricing
View Details
PI 3-kinase C2α (G-5) HRP
sc-365290 HRP 200 µg/mL

PI 3-kinase C2α (G-5) HRP

Sign In for Pricing
View Details
Lentiviral mouse Cldn18 shRNA (UAS) - Lentiviral mouse Cldn18 shRNA (UAS, RFP) plasmid
GTR15165349 1 Vial

Lentiviral mouse Cldn18 shRNA (UAS) - Lentiviral mouse Cldn18 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details