Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dhrs3 Peptide - middle region

Dhrs3 Peptide - middle region

Product Specifications

Product Name Alternative

Rsdr1, retSDR1

UniProt

O88876

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Dhrs3 Rabbit Polyclonal Antibody (orb579804) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_035433

Preservative

Lyophilized powder

AA Sequence

PGVSATTVLPFHTSTEMFQGMRVRFPNLFPPLKPETVARRTVDAVQQNQA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Desmoplakin (phospho-Ser165/166) rabbit pAb
UB-GEN-10197 100 µL

Desmoplakin (phospho-Ser165/166) rabbit pAb

Sign In for Pricing
View Details
COVID-19 Real-Time PCR Test
P0180 96 Tests

COVID-19 Real-Time PCR Test

Sign In for Pricing
View Details
Calpain 3 siRNA (h)
sc-41461 10 µM

Calpain 3 siRNA (h)

Sign In for Pricing
View Details
Goat Anti-Guinea Pig IgG H&L Secondary Antibody-AF750
TMAB-02038AF750-01 100 µL

Goat Anti-Guinea Pig IgG H&L Secondary Antibody-AF750

Sign In for Pricing
View Details
Goat Anti-Guinea Pig IgG H&L Secondary Antibody-AF750
TMAB-02038AF750-02 1 mL

Goat Anti-Guinea Pig IgG H&L Secondary Antibody-AF750

Sign In for Pricing
View Details
ANXA2 (Phospho-Ser26) Antibody
E18-5440-2 100 µg -100 µL

ANXA2 (Phospho-Ser26) Antibody

Sign In for Pricing
View Details