Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dhrs7 Peptide - N-terminal region

Dhrs7 Peptide - N-terminal region

Product Specifications

Product Name Alternative

2310016E22Rik, 5730564L20Rik, AW061210, Retdsr4, Retsdr4

UniProt

Q9CXR1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Dhrs7 Rabbit Polyclonal Antibody (orb579985) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079798

Preservative

Lyophilized powder

AA Sequence

MVVWVTGASSGIGEELAFQLSKLGVSLVLSARRAQELERVKRRCLENGNL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

p8 (NUPR1) Human Gene Knockout Kit (CRISPR)
KN400585 1 Kit

p8 (NUPR1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MSK1 (RPS6KA5) (NM_182398) Human Over-expression Lysate
LY403633 100 µg

MSK1 (RPS6KA5) (NM_182398) Human Over-expression Lysate

Sign In for Pricing
View Details
SYNPR (NM_144642) Human Recombinant Protein
TP305424M 100 µg

SYNPR (NM_144642) Human Recombinant Protein

Sign In for Pricing
View Details
gamma Synuclein (SNCG) Rabbit Polyclonal Antibody
TA368740 100 µL

gamma Synuclein (SNCG) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Ioticasone Furoate
TRC-I736320-2.5MG 2.5 mg

Ioticasone Furoate

Sign In for Pricing
View Details
Mouse IgG3 (Fcγ Fragment specific), AlpHcAbs® Goat antibody
HA710132 100 µg

Mouse IgG3 (Fcγ Fragment specific), AlpHcAbs® Goat antibody

Sign In for Pricing
View Details