Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dhrs7 Peptide - N-terminal region

Dhrs7 Peptide - N-terminal region

Product Specifications

Product Name Alternative

2310016E22Rik, 5730564L20Rik, AW061210, Retdsr4, Retsdr4

UniProt

Q9CXR1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Dhrs7 Rabbit Polyclonal Antibody (orb579985) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079798

Preservative

Lyophilized powder

AA Sequence

MVVWVTGASSGIGEELAFQLSKLGVSLVLSARRAQELERVKRRCLENGNL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPAN (NM_020230) Human Over-expression Lysate
LC402764 20 µg

PPAN (NM_020230) Human Over-expression Lysate

Sign In for Pricing
View Details
(2R,3R)-Bis(diphenylphosphino)butane
TRC-B430380-25MG 25 mg

(2R,3R)-Bis(diphenylphosphino)butane

Sign In for Pricing
View Details
ALG1L2 (NM_001136152) Human Over-expression Lysate
LC427825 20 µg

ALG1L2 (NM_001136152) Human Over-expression Lysate

Sign In for Pricing
View Details
ZPBP2 (NM_199321) Human Recombinant Protein
TP317396 20 µg

ZPBP2 (NM_199321) Human Recombinant Protein

Sign In for Pricing
View Details
MYO1B Recombinant Rabbit Monoclonal Antibody [JE65-01]
HA721119 100 µL

MYO1B Recombinant Rabbit Monoclonal Antibody [JE65-01]

Sign In for Pricing
View Details
PE Anti-Human CD81 Antibody[1.3.3.22]
E-AB-F1073D-01 20 Tests

PE Anti-Human CD81 Antibody[1.3.3.22]

Sign In for Pricing
View Details