Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DHRSX Peptide - N-terminal region

DHRSX Peptide - N-terminal region

Product Specifications

Product Name Alternative

CXorf11, DHRS5X, DHRS5Y, DHRSXY, DHRSY, SDR46C1

UniProt

Q8N5I4

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DHRSX Rabbit Polyclonal Antibody (orb577317) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_660160

Preservative

Lyophilized powder

AA Sequence

GFLEPVFPPRPDRVAIVTGGTDGIGYSTAKHLARLGMHVIIAGNNDSKAK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal IL-12 R beta 1 Antibody (69310) [Janelia Fluor 635]
FAB839JF635 0.5 mL

Mouse Monoclonal IL-12 R beta 1 Antibody (69310) [Janelia Fluor 635]

Sign In for Pricing
View Details
Porcine Component of gems 4 (GEMIN4) ELISA Kit
MBS7217925-01 48 Well

Porcine Component of gems 4 (GEMIN4) ELISA Kit

Sign In for Pricing
View Details
Porcine Component of gems 4 (GEMIN4) ELISA Kit
MBS7217925-02 96 Well

Porcine Component of gems 4 (GEMIN4) ELISA Kit

Sign In for Pricing
View Details
Porcine Component of gems 4 (GEMIN4) ELISA Kit
MBS7217925-03 5x 96 Well

Porcine Component of gems 4 (GEMIN4) ELISA Kit

Sign In for Pricing
View Details
Porcine Component of gems 4 (GEMIN4) ELISA Kit
MBS7217925-04 10x 96 Well

Porcine Component of gems 4 (GEMIN4) ELISA Kit

Sign In for Pricing
View Details
HPCA Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
23853064 1.0 µg DNA

HPCA Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details