Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DHX38 Peptide - middle region

DHX38 Peptide - middle region

Product Specifications

Product Name Alternative

DDX38, KIAA0224, PRP16, PRPF16

UniProt

Q92620

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DHX38 Rabbit Polyclonal Antibody (orb575955) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_054722

Preservative

Lyophilized powder

AA Sequence

HKHWELAGTKLGDIMGVKKEEEPDKAVTEDGKVDYRTEQKFADHMKRKSE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LSMD1 Rabbit Polyclonal Antibody (BF647)
orb2480398 100 µL

LSMD1 Rabbit Polyclonal Antibody (BF647)

Sign In for Pricing
View Details
MCM9 (NM_017696) Human Tagged ORF Clone
RC231470 10 µg

MCM9 (NM_017696) Human Tagged ORF Clone

Sign In for Pricing
View Details
Guinea pig NKA (neurokinin A) ELISA Kit
MBS7618270-01 48 Well

Guinea pig NKA (neurokinin A) ELISA Kit

Sign In for Pricing
View Details
Guinea pig NKA (neurokinin A) ELISA Kit
MBS7618270-02 96 Well

Guinea pig NKA (neurokinin A) ELISA Kit

Sign In for Pricing
View Details
Guinea pig NKA (neurokinin A) ELISA Kit
MBS7618270-03 5x 96 Well

Guinea pig NKA (neurokinin A) ELISA Kit

Sign In for Pricing
View Details
Guinea pig NKA (neurokinin A) ELISA Kit
MBS7618270-04 10x 96 Well

Guinea pig NKA (neurokinin A) ELISA Kit

Sign In for Pricing
View Details