Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DHX57 Peptide - C-terminal region

DHX57 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DDX57, FLJ32861

UniProt

Q6P158

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_945314

Preservative

Lyophilized powder

AA Sequence

LSGRVLQEMASLKRQFTELLSDIGFAREGLRAREIEKRAQGGDGVLDATG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Braf Mouse Gene Knockout Kit (CRISPR)
KN502246 1 Kit

Braf Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD45RB (B-Cell Marker) (PTPRC/2877R), CF594 conjugate, 0.1mg/mL
BNC942877-500 1x 500 µL

CD45RB (B-Cell Marker) (PTPRC/2877R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Uterus
CS804338 5x 5 µm

Tissue FFPE Sections, Uterus

Sign In for Pricing
View Details
NCF4 Mouse Monoclonal Antibody [Clone ID: OTI1A7]
CF809197 100 µg

NCF4 Mouse Monoclonal Antibody [Clone ID: OTI1A7]

Sign In for Pricing
View Details
Recombinant GPA33 Monoclonal Antibody
AN300125P-01 20 µL

Recombinant GPA33 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant GPA33 Monoclonal Antibody
AN300125P-02 100 µL

Recombinant GPA33 Monoclonal Antibody

Sign In for Pricing
View Details