Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DHX8 Peptide - N-terminal region

DHX8 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DDX8, HRH1, PRP22, PRPF22

UniProt

Q14562

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DHX8 Rabbit Polyclonal Antibody (orb575940) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004932

Preservative

Lyophilized powder

AA Sequence

VKNGAEFTDSLISNLLRLIQTMRPPAKPSTSKDPVVKPKTEKEKLKELFP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human IL13RA1 Protein (His Tag)
PKSH033390-01 10 µg

Recombinant Human IL13RA1 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human IL13RA1 Protein (His Tag)
PKSH033390-02 50 µg

Recombinant Human IL13RA1 Protein (His Tag)

Sign In for Pricing
View Details
c Fos (FOS) Rabbit Polyclonal Antibody
AP06125PU-N 100 µg

c Fos (FOS) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary
CS620255 5x 5 µm

Frozen Tissue Sections, Ovary

Sign In for Pricing
View Details
C12orf69 (SMCO3) (NM_001013698) Human Over-expression Lysate
LY423021 100 µg

C12orf69 (SMCO3) (NM_001013698) Human Over-expression Lysate

Sign In for Pricing
View Details
PTPLA (HACD1) (NM_014241) Human Over-expression Lysate
LC402294 20 µg

PTPLA (HACD1) (NM_014241) Human Over-expression Lysate

Sign In for Pricing
View Details