Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dkk2 Peptide - middle region

Dkk2 Peptide - middle region

Product Specifications

UniProt

Q9QYZ8

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Dkk2 Rabbit Polyclonal Antibody (orb330796) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_064661

Preservative

Lyophilized powder

AA Sequence

NGICIPVTESILTPHIPALDGTRHRDRNHGHYSNHDLGWQNLGRPHSKMP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CAN508
C02056-5mg 5 mg

CAN508

Sign In for Pricing
View Details
SLC25A4 Antibody
CSB-PA021510LA01HU-01 50 µg

SLC25A4 Antibody

Sign In for Pricing
View Details
SLC25A4 Antibody
CSB-PA021510LA01HU-02 100 µg

SLC25A4 Antibody

Sign In for Pricing
View Details
Anti-KLF12 Antibody
MBS8304106-01 0.03 mL

Anti-KLF12 Antibody

Sign In for Pricing
View Details
Anti-KLF12 Antibody
MBS8304106-02 0.05 mL

Anti-KLF12 Antibody

Sign In for Pricing
View Details
Anti-KLF12 Antibody
MBS8304106-03 0.1 mL

Anti-KLF12 Antibody

Sign In for Pricing
View Details