Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DLG4 Peptide - middle region

DLG4 Peptide - middle region

Product Specifications

Product Name Alternative

PSD95, SAP90, SAP-90

UniProt

P78352

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DLG4 Rabbit Polyclonal Antibody (orb581300) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001356

Preservative

Lyophilized powder

AA Sequence

AAHLHPIAIFIRPRSLENVLEINKRITEEQARKAFDRATKLEQEFTECFS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BactoViewTM Dead 500/515
#40107 1x 100 µL

BactoViewTM Dead 500/515

Sign In for Pricing
View Details
ENDOGL1 (EXOG) (C-term) Goat Polyclonal Antibody
AP33495PU-N 100 µg

ENDOGL1 (EXOG) (C-term) Goat Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS808899 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
2-Nitro-4-chlorodiphenyl Ether
TRC-N495800-25G 25 g

2-Nitro-4-chlorodiphenyl Ether

Sign In for Pricing
View Details
TACC2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3C4]
TA803718BM 100 µL

TACC2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3C4]

Sign In for Pricing
View Details
Recombinant TMPRSS15 Antibody
RN-034-01 50 μL

Recombinant TMPRSS15 Antibody

Sign In for Pricing
View Details