Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DLG4 Peptide - middle region

DLG4 Peptide - middle region

Product Specifications

Product Name Alternative

PSD95, SAP90, SAP-90

UniProt

P78352

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DLG4 Rabbit Polyclonal Antibody (orb581300) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001356

Preservative

Lyophilized powder

AA Sequence

AAHLHPIAIFIRPRSLENVLEINKRITEEQARKAFDRATKLEQEFTECFS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Endometrium
CS625328 5x 5 µm

Frozen Tissue Sections, Endometrium

Sign In for Pricing
View Details
TEM1 (CD248) Rabbit Polyclonal Antibody
TA374427 100 µL

TEM1 (CD248) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse IL-5 Antibody Pair Set
E-KAB-0567 50 µL & 100 µg

Mouse IL-5 Antibody Pair Set

Sign In for Pricing
View Details
SCEL (NM_003843) Human Recombinant Protein
TP307214M 100 µg

SCEL (NM_003843) Human Recombinant Protein

Sign In for Pricing
View Details
RUNX1T1 (NM_175635) Human Recombinant Protein
TP322426L 1 mg

RUNX1T1 (NM_175635) Human Recombinant Protein

Sign In for Pricing
View Details
(RS)-3,5-DHPG
TRC-D450028-10MG 10 mg

(RS)-3,5-DHPG

Sign In for Pricing
View Details