Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DLST Peptide - C-terminal region

DLST Peptide - C-terminal region

Product Specifications

Product Name Alternative

DLTS

UniProt

P36957

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DLST Rabbit Polyclonal Antibody (orb331135) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001924

Preservative

Lyophilized powder

AA Sequence

FADIERTITELGEKARKNELAIEDMDGGTFTISNGGVFGSLFGTPIINPP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Neural Wiskott-Aldrich syndrome protein, WASL ELISA KIT
ELI-51488b 96 Tests

Bovine Neural Wiskott-Aldrich syndrome protein, WASL ELISA KIT

Sign In for Pricing
View Details
Adenosine Receptor A2a Polyclonal Antibody, HRP Conjugated
bs-1456R-HRP-01 20 µL

Adenosine Receptor A2a Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
Adenosine Receptor A2a Polyclonal Antibody, HRP Conjugated
bs-1456R-HRP-02 100 µL

Adenosine Receptor A2a Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
Human Complement fragment 3b rccptor (C3bR) ELISA Kit
GA-E0399HM-01 48 Tests

Human Complement fragment 3b rccptor (C3bR) ELISA Kit

Sign In for Pricing
View Details
Human Complement fragment 3b rccptor (C3bR) ELISA Kit
GA-E0399HM-02 96 Tests

Human Complement fragment 3b rccptor (C3bR) ELISA Kit

Sign In for Pricing
View Details
STAU2 Polyclonal Antibody
RD82913A-01 60 μL

STAU2 Polyclonal Antibody

Sign In for Pricing
View Details