Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DLST Peptide - C-terminal region

DLST Peptide - C-terminal region

Product Specifications

Product Name Alternative

DLTS

UniProt

P36957

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DLST Rabbit Polyclonal Antibody (orb331135) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001924

Preservative

Lyophilized powder

AA Sequence

FADIERTITELGEKARKNELAIEDMDGGTFTISNGGVFGSLFGTPIINPP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Apg3 (ATG3) Mouse Monoclonal Antibody [Clone ID: OTI2B9]
CF503384 100 µg

Apg3 (ATG3) Mouse Monoclonal Antibody [Clone ID: OTI2B9]

Sign In for Pricing
View Details
NAB2 Mouse Monoclonal Antibody [Clone 3H5]
E45M16227V-2 50 µL

NAB2 Mouse Monoclonal Antibody [Clone 3H5]

Sign In for Pricing
View Details
TRAF3  polyclonal antibody
BS76123 50ul

TRAF3 polyclonal antibody

Sign In for Pricing
View Details
Hoxc4, ID (Hoxc4, Hox-3.5, Hoxc-4, Homeobox protein Hox-C4, Homeobox protein Hox-3.5)
MBS645742-01 0.2 mL

Hoxc4, ID (Hoxc4, Hox-3.5, Hoxc-4, Homeobox protein Hox-C4, Homeobox protein Hox-3.5)

Sign In for Pricing
View Details
Hoxc4, ID (Hoxc4, Hox-3.5, Hoxc-4, Homeobox protein Hox-C4, Homeobox protein Hox-3.5)
MBS645742-02 5x 0.2 mL

Hoxc4, ID (Hoxc4, Hox-3.5, Hoxc-4, Homeobox protein Hox-C4, Homeobox protein Hox-3.5)

Sign In for Pricing
View Details
Cyclo-Cannabigerol
orb3136067-01 50 mg

Cyclo-Cannabigerol

Sign In for Pricing
View Details