Dlx4 Peptide - middle region
Dlx4 Peptide - middle region
Product Specifications
Product Name Alternative
Dlx-4, Dlx7, MGC129167
UniProt
P70436
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Dlx4 Rabbit Polyclonal Antibody (orb576115) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_031893
Preservative
Lyophilized powder
AA Sequence
AQLGLTQTQVKIWFQNKRSKYKKLLKQSSGEPEEDFSGRPPSLSPHSPAL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
bs-10956R-Biotin 100 µL
HDGF Polyclonal Antibody, Biotin Conjugated
Sign In for Pricing
View Details K3272403 1.0 µg DNA
Ccdc70 sgRNA CRISPR Lentivector (Mouse) (Target 2)
Sign In for Pricing
View Details 
abx412131 50 µg
HECT, UBA And WWE Domain Containing 1, E3 Ubiquitin Protein Ligase (HUWE1) Antibody
Sign In for Pricing
View Details M03566-carrier-free 100 µL
Anti-PNK / PNKP Rabbit Monoclonal Antibody, Carrier-free
Sign In for Pricing
View Details