Dlx4 Peptide - middle region
Dlx4 Peptide - middle region
Product Specifications
Product Name Alternative
Dlx-4, Dlx7, MGC129167
UniProt
P70436
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Dlx4 Rabbit Polyclonal Antibody (orb576115) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_031893
Preservative
Lyophilized powder
AA Sequence
AQLGLTQTQVKIWFQNKRSKYKKLLKQSSGEPEEDFSGRPPSLSPHSPAL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
RC203990L3V 200 µL
RCN1 (NM_002901) Human Tagged ORF Clone Lentiviral Particle
Sign In for Pricing
View Details 
45335064 1.0 µg DNA
SPINK5 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
Sign In for Pricing
View Details MBS1328679-01 0.02 mg (E-Coli)
Recombinant Xanthomonas campestris pv. campestris Ribosome-recycling factor (frr)
Sign In for Pricing
View Details MBS1328679-02 0.1 mg (E-Coli)
Recombinant Xanthomonas campestris pv. campestris Ribosome-recycling factor (frr)
Sign In for Pricing
View Details MBS1328679-03 0.02 mg (Yeast)
Recombinant Xanthomonas campestris pv. campestris Ribosome-recycling factor (frr)
Sign In for Pricing
View Details