Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dlx6 Peptide - C-terminal region

Dlx6 Peptide - C-terminal region

Product Specifications

Product Name Alternative

RGD1561539

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Dlx6 Rabbit Polyclonal Antibody (orb575612) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_575377

Preservative

Lyophilized powder

AA Sequence

FQQTQYLALPERAELAASLGLTQTQVKIWFQNKRSKFKKLLKQGSNPHES

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-ROS1 Antibody
orb1675161 0.1 mL

Anti-ROS1 Antibody

Sign In for Pricing
View Details
AKT3, CT (RAC-gamma Serine/Threonine-protein Kinase, RAC-PK-gamma, Protein Kinase Akt-3, Protein Kinase B, gamma, PKB gamma, STK-2, PKBG) (MaxLight 405)
MBS6462154-01 0.1 mL

AKT3, CT (RAC-gamma Serine/Threonine-protein Kinase, RAC-PK-gamma, Protein Kinase Akt-3, Protein Kinase B, gamma, PKB gamma, STK-2, PKBG) (MaxLight 405)

Sign In for Pricing
View Details
AKT3, CT (RAC-gamma Serine/Threonine-protein Kinase, RAC-PK-gamma, Protein Kinase Akt-3, Protein Kinase B, gamma, PKB gamma, STK-2, PKBG) (MaxLight 405)
MBS6462154-02 5x 0.1 mL

AKT3, CT (RAC-gamma Serine/Threonine-protein Kinase, RAC-PK-gamma, Protein Kinase Akt-3, Protein Kinase B, gamma, PKB gamma, STK-2, PKBG) (MaxLight 405)

Sign In for Pricing
View Details
Porcine N-Terminal EF-Hand Calcium-Binding Protein 1 (NECAB1) ELISA Kit
MBS9901445-01 48 Well

Porcine N-Terminal EF-Hand Calcium-Binding Protein 1 (NECAB1) ELISA Kit

Sign In for Pricing
View Details
Porcine N-Terminal EF-Hand Calcium-Binding Protein 1 (NECAB1) ELISA Kit
MBS9901445-02 96 Well

Porcine N-Terminal EF-Hand Calcium-Binding Protein 1 (NECAB1) ELISA Kit

Sign In for Pricing
View Details
Porcine N-Terminal EF-Hand Calcium-Binding Protein 1 (NECAB1) ELISA Kit
MBS9901445-03 5x 96 Well

Porcine N-Terminal EF-Hand Calcium-Binding Protein 1 (NECAB1) ELISA Kit

Sign In for Pricing
View Details