Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dlx6 Peptide - C-terminal region

Dlx6 Peptide - C-terminal region

Product Specifications

Product Name Alternative

RGD1561539

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Dlx6 Rabbit Polyclonal Antibody (orb575612) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_575377

Preservative

Lyophilized powder

AA Sequence

FQQTQYLALPERAELAASLGLTQTQVKIWFQNKRSKFKKLLKQGSNPHES

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fam46b (NM_001107907) Rat Tagged ORF Clone Lentiviral Particle
RR211294L4V 200 µL

Fam46b (NM_001107907) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
ETV7 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
19538061 1.0 µg DNA

ETV7 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
HSF4 (Heat Shock Transcription Factor 4, CTM) (MaxLight 750)
MBS6238764-01 0.1 mL

HSF4 (Heat Shock Transcription Factor 4, CTM) (MaxLight 750)

Sign In for Pricing
View Details
HSF4 (Heat Shock Transcription Factor 4, CTM) (MaxLight 750)
MBS6238764-02 5x 0.1 mL

HSF4 (Heat Shock Transcription Factor 4, CTM) (MaxLight 750)

Sign In for Pricing
View Details
Recombinant Influenza A virus Matrix protein 2 (M), partial
MBS7090452 Inquire

Recombinant Influenza A virus Matrix protein 2 (M), partial

Sign In for Pricing
View Details
TRAK1 Blocking Peptide
33R-4044 100 ug

TRAK1 Blocking Peptide

Sign In for Pricing
View Details