Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DMBT1 Peptide - N-terminal region

DMBT1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

GP340, MGC164738, muclin

UniProt

Q9UGM3

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DMBT1 Rabbit Polyclonal Antibody (orb578441) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_015568

Preservative

Lyophilized powder

AA Sequence

SWSTPSPDTLPTITLPASTVGSESSLALRLVNGGDRCQGRVEVLYRGSWG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant ASFV Pret-137 Protein (aa 1-184)
VAng-2428Lsx-500g 500 µg

Recombinant ASFV Pret-137 Protein (aa 1-184)

Sign In for Pricing
View Details
Rno-miR-146b-5p mimic
HY-R04238-01 5 nmol

Rno-miR-146b-5p mimic

Sign In for Pricing
View Details
Rno-miR-146b-5p mimic
HY-R04238-02 20 nmol

Rno-miR-146b-5p mimic

Sign In for Pricing
View Details
Sheep Coiled coil domain containing protein KIAA1826 (KIAA1826) ELISA Kit
GTR10346779 96 Well

Sheep Coiled coil domain containing protein KIAA1826 (KIAA1826) ELISA Kit

Sign In for Pricing
View Details
EIF5B Antibody
ABD4055 100 µg

EIF5B Antibody

Sign In for Pricing
View Details
Sheep Leukocyte Antigen C (HLA-C) ELISA Kit
MBS9926129-01 48 Well

Sheep Leukocyte Antigen C (HLA-C) ELISA Kit

Sign In for Pricing
View Details