Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DMBT1 Peptide - N-terminal region

DMBT1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

GP340, MGC164738, muclin

UniProt

Q9UGM3

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DMBT1 Rabbit Polyclonal Antibody (orb578441) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_015568

Preservative

Lyophilized powder

AA Sequence

SWSTPSPDTLPTITLPASTVGSESSLALRLVNGGDRCQGRVEVLYRGSWG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATF6 Mouse mAb
F0822-20uL 20 µL

ATF6 Mouse mAb

Sign In for Pricing
View Details
RGS11 Antibody
40074 100 µL

RGS11 Antibody

Sign In for Pricing
View Details
MT-ND4L Polyclonal Antibody
E910711 100 µL

MT-ND4L Polyclonal Antibody

Sign In for Pricing
View Details
IGSF11 Mouse Monoclonal Antibody [Clone ID: LBI1B9]
AMM16142V 100 µL

IGSF11 Mouse Monoclonal Antibody [Clone ID: LBI1B9]

Sign In for Pricing
View Details
3-[5- (1-Methyl-1H-pyrazol-4-yl) -1,2,4-oxadiazol-3-yl]morpholine
LIC70569-01 50 mg

3-[5- (1-Methyl-1H-pyrazol-4-yl) -1,2,4-oxadiazol-3-yl]morpholine

Sign In for Pricing
View Details
3-[5- (1-Methyl-1H-pyrazol-4-yl) -1,2,4-oxadiazol-3-yl]morpholine
LIC70569-02 0.5 g

3-[5- (1-Methyl-1H-pyrazol-4-yl) -1,2,4-oxadiazol-3-yl]morpholine

Sign In for Pricing
View Details