Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dmrt1 Peptide - C-terminal region

Dmrt1 Peptide - C-terminal region

Product Specifications

UniProt

Q6Y951

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Dmrt1 Rabbit Polyclonal Antibody (orb576244) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_056641

Preservative

Lyophilized powder

AA Sequence

VFSPPSSQDSGLVSLSSSSPMSNESSKGVLECESASSEPSSYAVNQVLEE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat Anti-Human IgG Fc - Alexa Fluor 488
MBS4517073-01 0.1 mL

Goat Anti-Human IgG Fc - Alexa Fluor 488

Sign In for Pricing
View Details
Goat Anti-Human IgG Fc - Alexa Fluor 488
MBS4517073-02 0.5 mL

Goat Anti-Human IgG Fc - Alexa Fluor 488

Sign In for Pricing
View Details
Goat Anti-Human IgG Fc - Alexa Fluor 488
MBS4517073-03 1 mL

Goat Anti-Human IgG Fc - Alexa Fluor 488

Sign In for Pricing
View Details
Goat Anti-Human IgG Fc - Alexa Fluor 488
MBS4517073-04 5x 1 mL

Goat Anti-Human IgG Fc - Alexa Fluor 488

Sign In for Pricing
View Details
Rabbit Polyclonal SLC45A3/Prostein Antibody [DyLight 755]
NB200-129IR 0.1 mL

Rabbit Polyclonal SLC45A3/Prostein Antibody [DyLight 755]

Sign In for Pricing
View Details
BTBD17 CRISPR/Cas9 KO Plasmid (h)
sc-415781 20 µg

BTBD17 CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details