Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dmrt1 Peptide - C-terminal region

Dmrt1 Peptide - C-terminal region

Product Specifications

UniProt

Q6Y951

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Dmrt1 Rabbit Polyclonal Antibody (orb576244) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_056641

Preservative

Lyophilized powder

AA Sequence

VFSPPSSQDSGLVSLSSSSPMSNESSKGVLECESASSEPSSYAVNQVLEE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Neisseria meningitidis serogroup B Uncharacterized membrane protein NMB1645 (NMB1645), partial
MBS7101852 Inquire

Recombinant Neisseria meningitidis serogroup B Uncharacterized membrane protein NMB1645 (NMB1645), partial

Sign In for Pricing
View Details
AMACR Antibody
orb3162744-01 50 µL

AMACR Antibody

Sign In for Pricing
View Details
AMACR Antibody
orb3162744-02 100 µL

AMACR Antibody

Sign In for Pricing
View Details
Porcine Arf GAP with GTPase, ANK repeat and PH domain containing protein 4 (AGAP4) ELISA kit
GTR10464452 96 Well

Porcine Arf GAP with GTPase, ANK repeat and PH domain containing protein 4 (AGAP4) ELISA kit

Sign In for Pricing
View Details
Mouse Dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide (DAPP1) ELISA Kit
AE47872MO-01 48 Tests

Mouse Dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide (DAPP1) ELISA Kit

Sign In for Pricing
View Details
Mouse Dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide (DAPP1) ELISA Kit
AE47872MO-02 96 Tests

Mouse Dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide (DAPP1) ELISA Kit

Sign In for Pricing
View Details