DMRT3 Peptide - middle region
DMRT3 Peptide - middle region
Product Specifications
Product Name Alternative
DMRTA3, MGC142144
UniProt
Q9NQL9
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with DMRT3 Rabbit Polyclonal Antibody (orb574557) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_067063
Preservative
Lyophilized powder
AA Sequence
ALQAQLAKPDLTEERLGDGKSADNTEVFSDKDTDQRSSPDVAKSKGCFTP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS2137071-01 0.1 mL
APC_Cy7 Linked Monoclonal Antibody to Dual Specificity Phosphatase 3 (DUSP3)
Sign In for Pricing
View Details MBS2137071-02 0.2 mL
APC_Cy7 Linked Monoclonal Antibody to Dual Specificity Phosphatase 3 (DUSP3)
Sign In for Pricing
View Details MBS2137071-03 0.5 mL
APC_Cy7 Linked Monoclonal Antibody to Dual Specificity Phosphatase 3 (DUSP3)
Sign In for Pricing
View Details MBS2137071-04 1 mL
APC_Cy7 Linked Monoclonal Antibody to Dual Specificity Phosphatase 3 (DUSP3)
Sign In for Pricing
View Details MBS2137071-05 5 mL
APC_Cy7 Linked Monoclonal Antibody to Dual Specificity Phosphatase 3 (DUSP3)
Sign In for Pricing
View Details MBS2137071-06 5x 5 mL
APC_Cy7 Linked Monoclonal Antibody to Dual Specificity Phosphatase 3 (DUSP3)
Sign In for Pricing
View Details