Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DMRT3 Peptide - middle region

DMRT3 Peptide - middle region

Product Specifications

Product Name Alternative

DMRTA3, MGC142144

UniProt

Q9NQL9

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DMRT3 Rabbit Polyclonal Antibody (orb574557) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_067063

Preservative

Lyophilized powder

AA Sequence

ALQAQLAKPDLTEERLGDGKSADNTEVFSDKDTDQRSSPDVAKSKGCFTP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PNP ELISA Kit PicoKine
MBS1759839-01 96 Well

Human PNP ELISA Kit PicoKine

Sign In for Pricing
View Details
Human PNP ELISA Kit PicoKine
MBS1759839-02 5x 96 Well

Human PNP ELISA Kit PicoKine

Sign In for Pricing
View Details
Sheep Resolvin D1 ELISA Kit
MBS7266457-01 48 Well

Sheep Resolvin D1 ELISA Kit

Sign In for Pricing
View Details
Sheep Resolvin D1 ELISA Kit
MBS7266457-02 96 Well

Sheep Resolvin D1 ELISA Kit

Sign In for Pricing
View Details
Sheep Resolvin D1 ELISA Kit
MBS7266457-03 5x 96 Well

Sheep Resolvin D1 ELISA Kit

Sign In for Pricing
View Details
Sheep Resolvin D1 ELISA Kit
MBS7266457-04 10x 96 Well

Sheep Resolvin D1 ELISA Kit

Sign In for Pricing
View Details