Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dmrtb1 Peptide - C-terminal region

Dmrtb1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Dmrt6, Prp13, Dmrtb1

UniProt

A2A9I7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Dmrtb1 Rabbit Polyclonal Antibody (orb576367) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_063925

Preservative

Lyophilized powder

AA Sequence

PHFLPPGYLSALHFLPPPPPPPSPPSFSLTYDTDKENTNDQDAEAPTEPS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine Fibronectin (FN) ELISA Kit
MBS2605139-01 48 Well

Canine Fibronectin (FN) ELISA Kit

Sign In for Pricing
View Details
Canine Fibronectin (FN) ELISA Kit
MBS2605139-02 96 Well

Canine Fibronectin (FN) ELISA Kit

Sign In for Pricing
View Details
Canine Fibronectin (FN) ELISA Kit
MBS2605139-03 5x 96 Well

Canine Fibronectin (FN) ELISA Kit

Sign In for Pricing
View Details
Canine Fibronectin (FN) ELISA Kit
MBS2605139-04 10x 96 Well

Canine Fibronectin (FN) ELISA Kit

Sign In for Pricing
View Details
Recombinant Epstein-Barr Virus (EBV-EBNA-1) Antigen
OPEF01346-100UG 100 µg

Recombinant Epstein-Barr Virus (EBV-EBNA-1) Antigen

Sign In for Pricing
View Details
TCEB1P18 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
46347061 1.0 µg DNA

TCEB1P18 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details