Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dmrtb1 Peptide - C-terminal region

Dmrtb1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Dmrt6, Prp13, Dmrtb1

UniProt

A2A9I7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Dmrtb1 Rabbit Polyclonal Antibody (orb576367) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_063925

Preservative

Lyophilized powder

AA Sequence

PHFLPPGYLSALHFLPPPPPPPSPPSFSLTYDTDKENTNDQDAEAPTEPS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MECP2 Rabbit Polyclonal Antibody
orb588137 100 µL

MECP2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
[Ala1]-PAR-4 (1-6) amide (mouse)
PA16865-01 1 mg

[Ala1]-PAR-4 (1-6) amide (mouse)

Sign In for Pricing
View Details
[Ala1]-PAR-4 (1-6) amide (mouse)
PA16865-02 10 mg

[Ala1]-PAR-4 (1-6) amide (mouse)

Sign In for Pricing
View Details
[Ala1]-PAR-4 (1-6) amide (mouse)
PA16865-03 100 mg

[Ala1]-PAR-4 (1-6) amide (mouse)

Sign In for Pricing
View Details
Trx (bovine) -PR
sc-270498-PR 10 µM - 20 µL

Trx (bovine) -PR

Sign In for Pricing
View Details
GATA2 Recombinant Protein
OPCD03452-10UG 10 µg

GATA2 Recombinant Protein

Sign In for Pricing
View Details