Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DNAI2 Peptide - N-terminal region

DNAI2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CILD9

UniProt

Q9GZS0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DNAI2 Rabbit Polyclonal Antibody (orb330248) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_075462

Preservative

Lyophilized powder

AA Sequence

TRGVNHVEGGWPKDVNPLELEQTIRFRKKVEKDENYVNAIMQLGSIMEHC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADH5 (NM_000671) Human Over-expression Lysate
LC400220 20 µg

ADH5 (NM_000671) Human Over-expression Lysate

Sign In for Pricing
View Details
Nicotine N-beta-D-Glucuronide
TRC-N424575-1MG 1 mg

Nicotine N-beta-D-Glucuronide

Sign In for Pricing
View Details
Bis(2-ethylhexyl)adipate-13C6
TRC-B433813-5MG 5 mg

Bis(2-ethylhexyl)adipate-13C6

Sign In for Pricing
View Details
CHIT1 (NM_003465) Human Recombinant Protein
TP720378L 500 µg

CHIT1 (NM_003465) Human Recombinant Protein

Sign In for Pricing
View Details
NOL10 Antibody
8C17154-AAT 50 µg

NOL10 Antibody

Sign In for Pricing
View Details
Melatonin Receptor 1A (MTNR1A) (NM_005958) Human Over-expression Lysate
LC401806 20 µg

Melatonin Receptor 1A (MTNR1A) (NM_005958) Human Over-expression Lysate

Sign In for Pricing
View Details