Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DNAI2 Peptide - N-terminal region

DNAI2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CILD9

UniProt

Q9GZS0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DNAI2 Rabbit Polyclonal Antibody (orb330248) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_075462

Preservative

Lyophilized powder

AA Sequence

TRGVNHVEGGWPKDVNPLELEQTIRFRKKVEKDENYVNAIMQLGSIMEHC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Azosemide
TRC-A965145-50MG 50 mg

Azosemide

Sign In for Pricing
View Details
Pgp9.5 (UCHL-1) (31A3), Biotin conjugate, 0.1mg/mL
BNCB0046-500 1x 500 µL

Pgp9.5 (UCHL-1) (31A3), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ZSTK 474
TRC-Z701000-10MG 10 mg

ZSTK 474

Sign In for Pricing
View Details
Rasgrf1 Mouse Gene Knockout Kit (CRISPR)
KN514501 1 Kit

Rasgrf1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cytokeratin, pan (AE-1 / AE-3), Biotin conjugate, 0.1mg/mL
BNCB0371-500 1x 500 µL

Cytokeratin, pan (AE-1 / AE-3), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse Phb2 activation kit by CRISPRa
GA200375 1 Kit

Mouse Phb2 activation kit by CRISPRa

Sign In for Pricing
View Details