Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dnaja1 Peptide - N-terminal region

Dnaja1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Hsj2, Nedd7

UniProt

P63037

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Dnaja1 Rabbit Polyclonal Antibody (orb582392) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_032324

Preservative

Lyophilized powder

AA Sequence

YDVLGVKPNATQEELKKAYRKLALKYHPDKNPNEGEKFKQISQAYEVLAD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Claspin (B-6) Alexa Fluor® 790
sc-376773 AF790 200 µg/mL

Claspin (B-6) Alexa Fluor® 790

Sign In for Pricing
View Details
β-Casomorphin [D-Pro2] [1-5] amide (bovine)
C1500-20 1 mg

β-Casomorphin [D-Pro2] [1-5] amide (bovine)

Sign In for Pricing
View Details
CCL3 Antibody
K24010M02C08C-01 50 ug

CCL3 Antibody

Sign In for Pricing
View Details
CCL3 Antibody
K24010M02C08C-02 100 ug

CCL3 Antibody

Sign In for Pricing
View Details
CCL3 Antibody
K24010M02C08C-03 1 mg

CCL3 Antibody

Sign In for Pricing
View Details
LARG/ARHGEF12 Rabbit Polyclonal Antibody (PE)
orb2582377 100 µg

LARG/ARHGEF12 Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details